DictBridge Dictionary

seventh Definition and Meaning in English (seventh definition)

adjective
Synonyms:7th
Quick Answer • Definition

Seventh definition: Referring to the position in a sequence that is immediately after the sixth position.

Definitions of Seventh

  1. 1adjective

    Referring to the position in a sequence that is immediately after the sixth position.

  2. 2determiner

    Constituting one of seven equal parts of a whole.

Example Sentences

casual

“She finished in seventh place in the race.”

casual

“This is the seventh chapter of the book.”

Synonyms

7th

Antonyms

Explore Vocabulary by Topic

Popular Topics
All 45+ Topics
Business & FinanceCommon AnimalsBasic FoodsDaily Actions (Verbs)ClothingCommon BirdsView All Topics (45+)

Inflected Word Forms

nounseven
pluralsevenths

Phrases & Idiomatic Expressions

seventh heavenidiom

A state of extreme happiness.

Frequently Asked Questions: Seventh in English

What is the meaning of Seventh in English?▼
Seventh definition: Referring to the position in a sequence that is immediately after the sixth position.
How do you translate 'Seventh' to English?▼
'Seventh' translates to 'seventh' in English. Seventh definition: Referring to the position in a sequence that is immediately after the sixth position.
How do you pronounce 'Seventh' and 'seventh'?▼
Listen to clear English audio pronunciation of 'Seventh' and native English audio speech for 'seventh' with bilingual sentence examples on DictBridge.

Related Vocabulary in English

All Words →

Explore contextually related English vocabulary with verified English meanings, pronunciations, and sentence usages:

springspringsunnysunnysssadsadsafesafesaidsaidsakesakesamesamesavesavesavedsavedsayingsayingsayssays