DictBridge Dictionary

sigma Definition and Meaning in English (sigma definition)

noun
Quick Answer • Definition

Sigma definition: Sigma is the eighteenth letter of the Greek alphabet, represented in uppercase as Σ and in lowercase as σ or ς.

Definitions of Sigma

  1. 1noun

    Sigma is the eighteenth letter of the Greek alphabet, represented in uppercase as Σ and in lowercase as σ or ς.

  2. 2noun

    In mathematics, the uppercase sigma (Σ) is commonly used as an operator for summation, indicating the sum of a sequence of terms.

  3. 3noun

    In statistics, the lowercase sigma (σ) is used to denote the population standard deviation, a measure of the amount of variation or dispersion of a set of values.

Example Sentences

“The Greek letter sigma is used in both uppercase and lowercase forms.”

“We used the sigma notation to calculate the total sum of the series.”

“A low sigma value indicates that the data points tend to be very close to the mean.”

Explore Vocabulary by Topic

Popular Topics
All 45+ Topics
Business & FinanceCommon AnimalsBasic FoodsDaily Actions (Verbs)ClothingCommon BirdsView All Topics (45+)

Inflected Word Forms

adjectivesigmatic

Frequently Asked Questions: Sigma in English

What is the meaning of Sigma in English?▼
Sigma definition: Sigma is the eighteenth letter of the Greek alphabet, represented in uppercase as Σ and in lowercase as σ or ς.
How do you translate 'Sigma' to English?▼
'Sigma' translates to 'sigma' in English. Sigma definition: Sigma is the eighteenth letter of the Greek alphabet, represented in uppercase as Σ and in lowercase as σ or ς.
How do you pronounce 'Sigma' and 'sigma'?▼
Listen to clear English audio pronunciation of 'Sigma' and native English audio speech for 'sigma' with bilingual sentence examples on DictBridge.

Related Vocabulary in English

All Words →

Explore contextually related English vocabulary with verified English meanings, pronunciations, and sentence usages:

springspringsunnysunnysssadsadsafesafesaidsaidsakesakesamesamesavesavesavedsavedsayingsayingsayssays