DictBridge Dictionary

sixtieth Definition and Meaning in English (sixtieth definition)

adjective
Quick Answer • Definition

Sixtieth definition: Being the ordinal number corresponding to sixty in a sequence or series.

Definitions of Sixtieth

  1. 1adjective

    Being the ordinal number corresponding to sixty in a sequence or series.

  2. 2noun

    One of sixty equal parts into which something is divided.

Example Sentences

“Today marks the sixtieth anniversary of the company's founding.”

“He was the sixtieth person to cross the finish line.”

“A sixtieth of a minute is one second.”

Explore Vocabulary by Topic

Popular Topics
All 45+ Topics
Business & FinanceCommon AnimalsBasic FoodsDaily Actions (Verbs)ClothingCommon BirdsView All Topics (45+)

Inflected Word Forms

nounsixty
pluralsixties

Frequently Asked Questions: Sixtieth in English

What is the meaning of Sixtieth in English?▼
Sixtieth definition: Being the ordinal number corresponding to sixty in a sequence or series.
How do you translate 'Sixtieth' to English?▼
'Sixtieth' translates to 'sixtieth' in English. Sixtieth definition: Being the ordinal number corresponding to sixty in a sequence or series.
How do you pronounce 'Sixtieth' and 'sixtieth'?▼
Listen to clear English audio pronunciation of 'Sixtieth' and native English audio speech for 'sixtieth' with bilingual sentence examples on DictBridge.

Related Vocabulary in English

All Words →

Explore contextually related English vocabulary with verified English meanings, pronunciations, and sentence usages:

springspringsunnysunnysssadsadsafesafesaidsaidsakesakesamesamesavesavesavedsavedsayingsayingsayssays