DictBridge Dictionary

spheres Definition and Meaning in English (spheres definition)

noun
Synonyms:globesorbs
Quick Answer • Definition

Spheres definition: A round solid three-dimensional object, like a ball or a planet.

Definitions of Spheres

  1. 1noun

    A round solid three-dimensional object, like a ball or a planet.

  2. 2noun

    An area of activity, interest, or influence, often used in a figurative sense.

  3. 3noun

    A celestial body or a distinct part of the universe, often referring to a specific domain.

Example Sentences

scientific

“The Earth is not a perfect sphere, but an oblate spheroid.”

academic

“These discussions often touch upon various spheres of human knowledge.”

artistic

“The artist's work explores new spheres of creativity.”

Synonyms

Explore Vocabulary by Topic

Popular Topics
All 45+ Topics
Business & FinanceCommon AnimalsBasic FoodsDaily Actions (Verbs)ClothingCommon BirdsView All Topics (45+)

Inflected Word Forms

nounsphere
nounsphericity
adjectivespherical
adverbspherically

Frequently Asked Questions: Spheres in English

What is the meaning of Spheres in English?▼
Spheres definition: A round solid three-dimensional object, like a ball or a planet.
How do you translate 'Spheres' to English?▼
'Spheres' translates to 'spheres' in English. Spheres definition: A round solid three-dimensional object, like a ball or a planet.
How do you pronounce 'Spheres' and 'spheres'?▼
Listen to clear English audio pronunciation of 'Spheres' and native English audio speech for 'spheres' with bilingual sentence examples on DictBridge.

Related Vocabulary in English

All Words →

Explore contextually related English vocabulary with verified English meanings, pronunciations, and sentence usages:

springspringsunnysunnysssadsadsafesafesaidsaidsakesakesamesamesavesavesavedsavedsayingsayingsayssays