DictBridge Dictionary

summation Definition and Meaning in English (summation definition)

noun
Synonyms:summaryrecapitulationabstract
Quick Answer • Definition

Summation definition: Summation refers to the act or process of summing up, or a concise review of the main points of something.

Definitions of Summation

  1. 1noun

    Summation refers to the act or process of summing up, or a concise review of the main points of something.

  2. 2noun(formal)

    In mathematics, summation is the operation of adding a sequence of numbers or quantities; the result is their sum or total.

Example Sentences

formal

“The lawyer presented a clear summation of the evidence to the jury.”

business

“The summation of all expenses showed we were over budget.”

Synonyms

summaryrecapitulationabstract

Antonyms

Explore Vocabulary by Topic

Popular Topics
All 45+ Topics
Business & FinanceCommon AnimalsBasic FoodsDaily Actions (Verbs)ClothingCommon BirdsView All Topics (45+)

Inflected Word Forms

infinitivesummarize
nounsum
nounsummary
adjectivesummative

Frequently Asked Questions: Summation in English

What is the meaning of Summation in English?▼
Summation definition: Summation refers to the act or process of summing up, or a concise review of the main points of something.
How do you translate 'Summation' to English?▼
'Summation' translates to 'summation' in English. Summation definition: Summation refers to the act or process of summing up, or a concise review of the main points of something.
How do you pronounce 'Summation' and 'summation'?▼
Listen to clear English audio pronunciation of 'Summation' and native English audio speech for 'summation' with bilingual sentence examples on DictBridge.

Related Vocabulary in English

All Words →

Explore contextually related English vocabulary with verified English meanings, pronunciations, and sentence usages:

springspringsunnysunnysssadsadsafesafesaidsaidsakesakesamesamesavesavesavedsavedsayingsayingsayssays