DictBridge Dictionary

sixteenth Definition and Meaning in English (sixteenth definition)

adjective
Synonyms:16th
Quick Answer • Definition

Sixteenth definition: Referring to the position of something that is number sixteen in a sequence.

Definitions of Sixteenth

  1. 1adjective

    Referring to the position of something that is number sixteen in a sequence.

  2. 2noun

    One of sixteen equal parts into which something is divided.

Example Sentences

casual

“She finished the race in sixteenth place.”

casual

“The sixteenth chapter of the book is very interesting.”

technical

“A sixteenth of an inch is a very small measurement.”

Synonyms

16th

Antonyms

Explore Vocabulary by Topic

Popular Topics
All 45+ Topics
Business & FinanceCommon AnimalsBasic FoodsDaily Actions (Verbs)ClothingCommon BirdsView All Topics (45+)

Inflected Word Forms

adverbsixteenthly

Frequently Asked Questions: Sixteenth in English

What is the meaning of Sixteenth in English?▼
Sixteenth definition: Referring to the position of something that is number sixteen in a sequence.
How do you translate 'Sixteenth' to English?▼
'Sixteenth' translates to 'sixteenth' in English. Sixteenth definition: Referring to the position of something that is number sixteen in a sequence.
How do you pronounce 'Sixteenth' and 'sixteenth'?▼
Listen to clear English audio pronunciation of 'Sixteenth' and native English audio speech for 'sixteenth' with bilingual sentence examples on DictBridge.

Related Vocabulary in English

All Words →

Explore contextually related English vocabulary with verified English meanings, pronunciations, and sentence usages:

springspringsunnysunnysssadsadsafesafesaidsaidsakesakesamesamesavesavesavedsavedsayingsayingsayssays