DictBridge Dictionary

sixth Definition and Meaning in English (sixth definition)

adjective
Synonyms:6th
Quick Answer • Definition

Sixth definition: Constituting number six in a sequence; the ordinal number corresponding to the cardinal number six.

Definitions of Sixth

  1. 1adjective

    Constituting number six in a sequence; the ordinal number corresponding to the cardinal number six.

Example Sentences

casual

“She finished in sixth place in the race.”

casual

“Today is the sixth day of the month.”

Synonyms

6th

Antonyms

Explore Vocabulary by Topic

Popular Topics
All 45+ Topics
Business & FinanceCommon AnimalsBasic FoodsDaily Actions (Verbs)ClothingCommon BirdsView All Topics (45+)

Inflected Word Forms

nounsix
adverbsixthly

Phrases & Idiomatic Expressions

sixth senseidiom

A supposed faculty of perception or intuition apart from the five senses.

Frequently Asked Questions: Sixth in English

What is the meaning of Sixth in English?▼
Sixth definition: Constituting number six in a sequence; the ordinal number corresponding to the cardinal number six.
How do you translate 'Sixth' to English?▼
'Sixth' translates to 'sixth' in English. Sixth definition: Constituting number six in a sequence; the ordinal number corresponding to the cardinal number six.
How do you pronounce 'Sixth' and 'sixth'?▼
Listen to clear English audio pronunciation of 'Sixth' and native English audio speech for 'sixth' with bilingual sentence examples on DictBridge.

Related Vocabulary in English

All Words →

Explore contextually related English vocabulary with verified English meanings, pronunciations, and sentence usages:

springspringsunnysunnysssadsadsafesafesaidsaidsakesakesamesamesavesavesavedsavedsayingsayingsayssays