DictBridge Dictionary

sorted Definition and Meaning in English (sorted definition)

adjective
Synonyms:organizedarrangedordered
Quick Answer • Definition

Sorted definition: Arranged in a particular order or sequence.

Definitions of Sorted

  1. 1adjective

    Arranged in a particular order or sequence.

  2. 2adjective(informal)

    Successfully dealt with or resolved, often implying that a problem or task is complete.

  3. 3adjective(informal)

    Having one's personal affairs or life well-organized and under control.

Example Sentences

“The files are all sorted by date.”

“Don't worry, the issue is sorted.”

“She feels completely sorted after organizing her finances.”

Synonyms

Antonyms

Explore Vocabulary by Topic

Popular Topics
All 45+ Topics
Business & FinanceCommon AnimalsBasic FoodsDaily Actions (Verbs)ClothingCommon BirdsView All Topics (45+)

Inflected Word Forms

infinitivesort
gerundsorting
agent nounsorter
adjectiveunsorted

Phrases & Idiomatic Expressions

get sortedexpression

To get one's affairs in order or to resolve a problem.

all sortedexpression

Everything is in order or has been resolved.

Frequently Asked Questions: Sorted in English

What is the meaning of Sorted in English?▼
Sorted definition: Arranged in a particular order or sequence.
How do you translate 'Sorted' to English?▼
'Sorted' translates to 'sorted' in English. Sorted definition: Arranged in a particular order or sequence.
How do you pronounce 'Sorted' and 'sorted'?▼
Listen to clear English audio pronunciation of 'Sorted' and native English audio speech for 'sorted' with bilingual sentence examples on DictBridge.

Related Vocabulary in English

All Words →

Explore contextually related English vocabulary with verified English meanings, pronunciations, and sentence usages:

springspringsunnysunnysssadsadsafesafesaidsaidsakesakesamesamesavesavesavedsavedsayingsayingsayssays